DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Jon74E

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:134/277 - (48%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVILAVTTVGQAAPSI-------SRVVNGTDSSVLKYPFVVSLRSYDGSHS---CGGSIISKH 64
            :::|.|.:...|::...:       .|:..|..:...::|:.|.|...:.:..   ||.|:||..
  Fly     5 TILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69

  Fly    65 FVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQ--------HEDFDPTRQNANDISL 121
            :::|||||..    ..::|.:.:..:..:.|     :::|:        |.|:: .:...|||:|
  Fly    70 YLLTAAHCVE----KAVAITYYLGGVLRLAP-----RQLIRSTNPEVHLHPDWN-CQSLENDIAL 124

  Fly   122 LMVEEPFEFDGV---SVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIY 182
            :.:.|    |.:   |:.|:.||.|:.:....|. |..:..||| :||...::.|.|:.|...:.
  Fly   125 VRLPE----DALLCDSIRPIRLPGLSSSRNSYDY-VPAIASGWGRMNDESTAISDNLRYVYRFVE 184

  Fly   183 SDEECTSRHNGQTDPKYHICGGVD-EGGKGQCSGDSGGPLIYNGQ------QVGIVSWSIKPCTV 240
            |:|:|...: ....|. :||  :| .|||..|:|||||||:|:..      .:|:.|:..|....
  Fly   185 SNEDCEYSY-ANIKPT-NIC--MDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT 245

  Fly   241 APYPGVYCKVSQYVDWI 257
            ..||.|:.:::.|:|||
  Fly   246 KGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 68/249 (27%)
Tryp_SPc 30..260 CDD:238113 69/250 (28%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.