DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and ovch1

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:246 Identity:76/246 - (30%)
Similarity:127/246 - (51%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTN--GRPA--DTLSIQFGVT 88
            ||::.|.::....:|:.|||: |:...:|||:|:.:.:|:||.||..  .:|:  :.:.....:.
Zfish    55 SRIIGGKEAWAHSWPWQVSLQ-YNDVPTCGGAILDQLWVITAGHCFKRYKKPSMWNAVVGLHNLD 118

  Fly    89 NISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPV-----ELPALAFAVP 148
            |.:......:.::||..|:::: .:.|.|||:||.::.|..|... |.|:     :||.|     
Zfish   119 NANESSRESIQVQKIFSHKNYN-QKTNENDIALLKLQSPLVFSKF-VRPIGVFNNDLPPL----- 176

  Fly   149 QSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQC 213
                 |...:.|||.....|.....||||::.:|..::|...:.|:. .|..||.|.:|||...|
Zfish   177 -----VTCTVTGWGSVTENGPQASRLQEVNVTVYEPQKCNRFYRGKV-LKSMICAGANEGGMDAC 235

  Fly   214 SGDSGGPL-IYNGQQ---VGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260
            .||||||| .::|::   .|:|||.: .|..|..||||..:..|..|:.|:
Zfish   236 QGDSGGPLSCFDGERYKLAGVVSWGV-GCGRAQKPGVYTTLYHYRQWMVSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/240 (30%)
Tryp_SPc 30..260 CDD:238113 73/242 (30%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 73/239 (31%)
Tryp_SPc 57..281 CDD:238113 72/238 (30%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.