DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG32374

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:259 Identity:74/259 - (28%)
Similarity:108/259 - (41%) Gaps:65/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92
            :|:|||......:.|:..:|. |:....||..|:::.:::||.||..|.|. ..:::.|.|. ..
  Fly    72 TRIVNGKKIKCSRAPYQCALH-YNNYFICGCVILNRRWILTAQHCKIGNPG-RYTVRAGSTQ-QR 133

  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPA----------LAFAV 147
            .|..:..::|.:.|.::...... ||:.::.::.|... |..|..|:||:          ||   
  Fly   134 RGGQLRHVQKTVCHPNYSEYTMK-NDLCMMKLKTPLNV-GRCVQKVKLPSTRTKRFPKCYLA--- 193

  Fly   148 PQSDAGVEGVLIGWGLNDTYG-SVQDTLQEV-----------------SLKIYSDEECTSRHNGQ 194
                       .||||..... :||..|:.|                 .:|||....|..|.|..
  Fly   194 -----------SGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRD 247

  Fly   195 TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |                 |||||||||::||...||.|:.| .|..|.|||||..|.||..|||
  Fly   248 T-----------------CSGDSGGPLVHNGVLYGITSFGI-GCASAKYPGVYVNVLQYTRWIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/255 (28%)
Tryp_SPc 30..260 CDD:238113 73/257 (28%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/255 (28%)
Tryp_SPc 74..295 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.