DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and mas

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:253 Identity:77/253 - (30%)
Similarity:119/253 - (47%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG--RPADTLSIQFGVTNI 90
            :|||.|.|....::.:.|:|.:....:.||.::|...:|:|||||...  |..|.:.::.|..::
  Fly   801 ARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDL 865

  Fly    91 S----AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF-DGVSVAPVELPALAFAVPQS 150
            :    :.|...:.:.....|.:.: ::...|||:||.:....|. |||.:  |.|||...:   .
  Fly   866 TRKYGSPGAQTLRVATTYIHHNHN-SQTLDNDIALLKLHGQAELRDGVCL--VCLPARGVS---H 924

  Fly   151 DAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTD-----PKYHICGGVDEGGK 210
            .||....:.|:|.....|.:...::|..:.|.||.||..:.|..|:     |....|.|.:| |.
  Fly   925 AAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEE-GH 988

  Fly   211 GQCSGDSGGPLIYNG----QQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIIS 264
            ..|.||.||||:...    :..|:|||.. .|.....||||.|.|.::.||  |||||
  Fly   989 DACQGDGGGPLVCQDDGFYELAGLVSWGF-GCGRQDVPGVYVKTSSFIGWI--NQIIS 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/243 (29%)
Tryp_SPc 30..260 CDD:238113 71/245 (29%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.