DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:281 Identity:92/281 - (32%)
Similarity:134/281 - (47%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLSLSLIVILAVTTVGQAAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTA 69
            ||.||  :.|:|...| |.|.| ||:|.|.:......|:.|::.|:..:| |||.::...:|:||
Human     3 DLVLS--IALSVGCTG-AVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAH-CGGVLVHPQWVLTA 63

  Fly    70 AHCTN-------GR-----PADT-----LSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNAN 117
            |||..       ||     |.||     :|..|         |:.:....:::|:...|...:::
Human    64 AHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSF---------PHPLYNMSLLKHQSLRPDEDSSH 119

  Fly   118 DISLLMVEEPFEF-DGVSV--APVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQD------- 172
            |:.||.:.||.:. |.|.|  .|.:.|||         |......||      ||::.       
Human   120 DLMLLRLSEPAKITDVVKVLGLPTQEPAL---------GTTCYASGW------GSIEPEEFLRPR 169

  Fly   173 TLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKP 237
            :||.|||.:.|::.| :|...:...::.:|.|:..|||..|.|||||||:.||...||.||..:|
Human   170 SLQCVSLHLLSNDMC-ARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEP 233

  Fly   238 CTVAPYPGVYCKVSQYVDWIK 258
            |.:...|.||.||..|..|||
Human   234 CALPEKPAVYTKVVHYRKWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/254 (31%)
Tryp_SPc 30..260 CDD:238113 80/256 (31%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.