DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK1

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:264 Identity:84/264 - (31%)
Similarity:123/264 - (46%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |.|.:.|::...|.|.|..||:|.|.:......|:..:|..: .:..|||.::.:.:|:|||||.
Human     4 LVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHF-STFQCGGILVHRQWVLTAAHCI 67

  Fly    74 NGRPADTLSIQFGVTNI--SAMGPNVVGIKKIIQHEDF------DPTRQ----NANDISLLMVEE 126
                :|...:..|..|:  .......|.:.:...|..|      :.|||    .::|:.||.:.|
Human    68 ----SDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTE 128

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSR 190
            |.:....:|..||||     ..:.:.|...:..||| :.....|..|.||.|.|||..::||...
Human   129 PADTITDAVKVVELP-----TEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKA 188

  Fly   191 H-NGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
            | ...||  :.:|.|..||||..|.|||||||:.:|...|:.||...||.....|.|..:|..||
Human   189 HVQKVTD--FMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYV 251

  Fly   255 DWIK 258
            .||:
Human   252 KWIE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/241 (31%)
Tryp_SPc 30..260 CDD:238113 76/243 (31%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.