DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG32269

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:232 Identity:73/232 - (31%)
Similarity:111/232 - (47%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92
            ||:|.||.:::...|::|.||.  ||:.|.||:|::.:|:|||||..|..|...:::.|.|.:..
  Fly   107 SRIVGGTSTTISTTPYIVQLRR--GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDG 169

  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV 157
            .......:..|.....|...:.|. |.:||.:.:       |:....:..::....:..||....
  Fly   170 SDGVTRSVSSIHVAPKFTSKKMNM-DAALLKLNQ-------SLTGTNIGTISMGNYRPKAGSRVR 226

  Fly   158 LIGWGLNDTYGS--VQDTLQEVSLKIYSDEECTSRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGG 219
            :.|||:... ||  ...|||...:::...::|...:.|| |..||.:|...  .||..|||||||
  Fly   227 IAGWGVTKE-GSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARA--AGKDSCSGDSGG 288

  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            |:..|...:||||:.. .|..|.|||||..|.....|
  Fly   289 PVTRNNTLLGIVSFGY-GCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 72/231 (31%)
Tryp_SPc 30..260 CDD:238113 71/230 (31%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 71/229 (31%)
Tryp_SPc 121..324 CDD:238113 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.