DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG9897

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:274 Identity:71/274 - (25%)
Similarity:129/274 - (47%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |:.:::|.:..:...|....|::||...::...|:..|: ..:....|||:||||::::|||.|.
  Fly     2 LAPLILLQIVALPWLALGDQRIINGNTVNIKDAPWYASI-IVNSKLKCGGAIISKNYILTAAKCV 65

  Fly    74 NGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPV 138
            :|..|.::.::.|.::....| ::.||.|:..|..:...|.: |:::||...|...... .:.|:
  Fly    66 DGYSARSIQVRLGTSSCGTSG-SIAGICKVKVHSQYSSWRFD-NNLALLKTCELLNTTD-EIKPI 127

  Fly   139 ELPALAFAVP--QSDAGVEG--------------VLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC 187
            |   .|..||  .|.|.|.|              :.|..|:.:....:...|....::|.|.::|
  Fly   128 E---RADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQC 189

  Fly   188 TSRHNGQTDPKYHICGGVD------EGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGV 246
            .:  :.:..|.|.:.|..|      ..|||.||.|.|.||:.:.:.|||:|.:  .|::.  |.|
  Fly   190 AA--DWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILSRA--GCSIK--PDV 248

  Fly   247 YCKVSQYVDWIKSN 260
            |..:..:.:|:.||
  Fly   249 YANILGHTNWLDSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 65/249 (26%)
Tryp_SPc 30..260 CDD:238113 65/251 (26%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.