DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG3700

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:274 Identity:84/274 - (30%)
Similarity:123/274 - (44%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGQAAPSISRVVNGTDSSVLKYPFVVSLRSY-------DGSHSCGGSIISKHFVMTAAHC--TNG 75
            |..|..|...:|.||.:|..::||:..:.::       |.:..||||::...||:|||||  |:.
  Fly    92 VRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE 156

  Fly    76 RPADTLSIQFG----VTNISAMGPNVVGIKKIIQ---------HEDFDPTRQN---ANDISLLMV 124
            ..|:.|...|.    |..:..:..|......::|         |..:|...:.   .|||:|:.:
  Fly   157 SKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL 221

  Fly   125 EEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV-LIGWGLNDTYGSVQDT-LQEVSLKIYSDEEC 187
            :...||:. .||.|.||      |.|...|:.| ..|||.  |...|:.: |.:|:|:.:|||.|
  Fly   222 DRKAEFND-HVAAVCLP------PDSGNDVQQVTAAGWGF--TADGVKSSHLLKVNLQRFSDEVC 277

  Fly   188 TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYN-------GQQVGIVSWSIKPCTVAPYPG 245
            ..|.....|.:...|.|........|:||||||:...       .|.:||||:.: .|.....|.
  Fly   278 QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPS 341

  Fly   246 VYCKVSQYVDWIKS 259
            ||.||..|.|||:|
  Fly   342 VYTKVHLYTDWIES 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/261 (30%)
Tryp_SPc 30..260 CDD:238113 81/264 (31%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/264 (31%)
Tryp_SPc 102..353 CDD:214473 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.