DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG4927

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:112/273 - (41%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVNGTDSSVLKYPFVVSL--RSYDGSH---SCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTN 89
            :|.|..::..::||:..|  |..:.|.   .||..||...||:|||||          ::...|.
  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHC----------LETSETK 159

  Fly    90 ISAMGPNVVGIKKII--------------QHEDF--------------DPTRQNANDISLLMVEE 126
            ...:.||..|.|.::              |.:||              |.|....|||:::.:|.
  Fly   160 EQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEM 224

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLI---GWGLNDTYGSVQDTLQEVSLKIYSDEECT 188
            ...|... |||..||.        |.|.|.:.:   |||.....|.....|.:|||..|...||:
  Fly   225 EATFSEY-VAPACLPL--------DGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECS 280

  Fly   189 SRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPL-----IYN--GQQVGIVSWSIKPCTVAPYPGV 246
            .|...:.|.:..:|.|........|.||||||:     ||:  .|.:||.|:.: .|.|...|.|
  Fly   281 QRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGL-VCGVQGLPSV 344

  Fly   247 YCKVSQYVDWIKS 259
            |.||..|.|||::
  Fly   345 YTKVHLYTDWIEN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/269 (29%)
Tryp_SPc 30..260 CDD:238113 80/273 (29%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 80/273 (29%)
Tryp_SPc 105..355 CDD:214473 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.