DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Ser8

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:128/269 - (47%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAA-------PSIS----RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSI 60
            :||.:...||:..:...|       |..|    |:|.||.||:...|:.|||:. .|||.|||||
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQR-SGSHFCGGSI 64

  Fly    61 ISKHFVMTAAHCTN-GRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMV 124
            ||.:.::|||||.: ......|.|:.| :|....|..:|.:..|..||.:: :....|||.::.:
  Fly    65 ISNNIIVTAAHCLDTPTTVSNLRIRAG-SNKRTYGGVLVEVAAIKAHEAYN-SNSKINDIGVVRL 127

  Fly   125 EEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS 189
            :....| |.::..:   .:|.|.|..  |....:.|||...|.|....||..|..:|....:|.|
  Fly   128 KTKLTF-GSTIKAI---TMASATPAH--GSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGS 186

  Fly   190 RHNGQTD--PKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            ...|...  ....||....  .|..|.|||||||:..||.||:|||. :.|.||.|||||..:::
  Fly   187 STYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWG-RDCAVANYPGVYANIAE 248

  Fly   253 YVDWIKSNQ 261
            ..||:...|
  Fly   249 LRDWVLQAQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/230 (36%)
Tryp_SPc 30..260 CDD:238113 82/232 (35%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/230 (36%)
Tryp_SPc 35..253 CDD:238113 81/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.