DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and gammaTry

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:264 Identity:82/264 - (31%)
Similarity:122/264 - (46%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVT--TVGQAAPS------ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65
            |..:::|:..  .:|...|.      ..|:|.|:.:::..:|:.:||:. .|||||||||.|.:.
  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSSNV 65

  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF 130
            ::|||||.....|..|.|:.|.:..|: |.....:.....||.::.... .|||:::.:.....|
  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSS-GGVTFSVSSFKNHEGYNANTM-VNDIAIIKINGALTF 128

  Fly   131 DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYG--SVQDTLQEVSLKIYSDEECTSRHNG 193
            ...      :.|:..|......|....:.||| ..:||  |:...||.|::.|.|..:|.|...|
  Fly   129 SST------IKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186

  Fly   194 QTDP--KYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            ....  ...||...  .||..|.|||||||:..|..||:|||.. .|..:.|||||..|:....|
  Fly   187 YGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSW 248

  Fly   257 IKSN 260
            :.||
  Fly   249 VISN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/231 (32%)
Tryp_SPc 30..260 CDD:238113 75/233 (32%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.