DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and thetaTry

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:268 Identity:83/268 - (30%)
Similarity:127/268 - (47%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPSI------------SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISK 63
            |:|:|....||.|....            .|:|.|.|:::..:|:.|||::..|||.||||:|::
  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68

  Fly    64 HFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPF 128
            ..|:|||||..||....:.::.|.| :...|..||.::::..:||:: ::....|:.:|.::|..
  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGST-LYNEGGIVVAVRELAYNEDYN-SKTMEYDVGILKLDEKV 131

  Fly   129 EFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYG--SVQDTLQEVSLKIYSDEECTSRH 191
            : :..::..:||     |......|...|:.|||....:.  ::..|||||.:.|...:.|.|  
  Fly   132 K-ETENIRYIEL-----ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS-- 188

  Fly   192 NGQTDPKY-------HICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCK 249
               .:.||       .:|  ..|..|..|.|||||||......||||||.. .|.....||||..
  Fly   189 ---DEYKYGEIIYDSMVC--AYEKKKDACQGDSGGPLAVGNTLVGIVSWGY-ACASNLLPGVYSD 247

  Fly   250 VSQYVDWI 257
            |.....||
  Fly   248 VPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/236 (32%)
Tryp_SPc 30..260 CDD:238113 76/237 (32%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 75/236 (32%)
Tryp_SPc 35..255 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.