DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and zetaTry

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:122/273 - (44%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVG---------QAAPSISRVVNGTDSSVLKYPFVVSLRSYDG--------SHSC 56
            |:.:|.|...|.|         ::.|. .|:|.|..:.:.:.|:.:||| |.|        .|.|
  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPD-GRIVGGYATDIAQVPYQISLR-YKGITTPENPFRHRC 72

  Fly    57 GGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVV-GIKKIIQHEDFDPTRQNANDIS 120
            ||||.::..::|||||..|..|....:..| ||.......|: .:|:|:.||.:.......|||:
  Fly    73 GGSIFNETTIVTAAHCVIGTVASQYKVVAG-TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136

  Fly   121 LLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDE 185
            :|.|:.|...:..::..::|     |:.|...|....:.|||.....|...:.|..|.:.|.|:|
  Fly   137 ILFVDPPLPLNNFTIKAIKL-----ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196

  Fly   186 ECTSRHNGQTDPKYHI-----CGGV-DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYP 244
            .|...:....|..|.|     |.|. ..||...|.|||||||....:..|:|||. ..|.:..||
  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYP 260

  Fly   245 GVYCKVSQYVDWI 257
            |||..|:....||
  Fly   261 GVYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/242 (31%)
Tryp_SPc 30..260 CDD:238113 77/243 (32%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/242 (31%)
Tryp_SPc 39..276 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.