DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and lambdaTry

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:263 Identity:92/263 - (34%)
Similarity:142/263 - (53%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQA------------APSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIIS 62
            ::|:..|..||.:            .|.: .|:|.|.|:::.:||..:|:| |.|:|.|||:|..
  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMR-YRGNHRCGGTIYR 67

  Fly    63 KHFVMTAAHCTNGRPA-DTLSIQFGVTNI-SAMGP-NVVGIKKIIQHEDFDPTRQNANDISLLMV 124
            .:.:::||||.|.... :.|:|..|.:|| ...|| ..:.:::||.|..: .|..|..|.::|::
  Fly    68 SNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY-RTLNNDYDAAILIL 131

  Fly   125 EEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS 189
            :..|||:. :|.|:|   ||...|..|..|  .:.|||.....|::.|.|||||:.:..:..|.:
  Fly   132 DGDFEFND-AVQPIE---LAKERPDHDTPV--TVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKN 190

  Fly   190 RHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
            .::.....:. :|.||:.|||..|.|||||||:||...:|||||. ..|....||||||.|...:
  Fly   191 AYSIMLTSRM-LCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG-TGCAREKYPGVYCSVPDVL 253

  Fly   255 DWI 257
            ||:
  Fly   254 DWL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 86/230 (37%)
Tryp_SPc 30..260 CDD:238113 86/231 (37%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/229 (37%)
Tryp_SPc 36..259 CDD:238113 86/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.