DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:249 Identity:75/249 - (30%)
Similarity:127/249 - (51%) Gaps:25/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AAPSI---SRVVNGTDSSVLKYPFVVSLRSYDGS-HSCGGSIISKHFVMTAAHCTNGRPADTLSI 83
            |.|::   :|||.|..::..:.|:.|||:  :|| |.||.:::...::::||||.|....:.:..
Human   528 ARPAMEKPTRVVGGFGAASGEVPWQVSLK--EGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRA 590

  Fly    84 QFGVTNISAMG--PNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFA 146
            ..|..::..:|  |..:|:::::.|..::|...:. |:::|.:..|..|:.. :.||.||   .|
Human   591 HLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDF-DLAVLELASPLAFNKY-IQPVCLP---LA 650

  Fly   147 VPQSDAGVEGVLIGWGLNDTYGSV--QDTLQEVSLKIYSDEECTSRHN-GQTDPKYHICGGVDEG 208
            :.:...|.:.::.||| |...|:.  .:.||:.|:.|...:.|:..:| ..||..  ||.|..||
Human   651 IQKFPVGRKCMISGWG-NTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM--ICAGFLEG 712

  Fly   209 GKGQCSGDSGGPLIYNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ....|.|||||||......     .|||||.| .|.....||||.::::...||
Human   713 KVDSCQGDSGGPLACEEAPGVFYLAGIVSWGI-GCAQVKKPGVYTRITRLKGWI 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/238 (30%)
Tryp_SPc 30..260 CDD:238113 72/239 (30%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.