DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:270 Identity:86/270 - (31%)
Similarity:124/270 - (45%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG 75
            :.:.|:||.:|.|...:||:|.|.:......|:.|.:.| .|...|||.::...:|:|||||...
Human     6 VFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVAS-RGRAVCGGVLVHPQWVLTAAHCIRN 69

  Fly    76 R------------PADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPF 128
            :            |.||..    |..:|...|:.:....::::....|...:::|:.||.:.||.
Human    70 KSVILLGRHSLFHPEDTGQ----VFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPA 130

  Fly   129 EF-DGVSV--APVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ-------DTLQEVSLKIYS 183
            |. |.|.|  .|.:.|||         |......||      ||::       ..||.|.|.:.|
Human   131 ELTDAVKVMDLPTQEPAL---------GTTCYASGW------GSIEPEEFLTPKKLQCVDLHVIS 180

  Fly   184 DEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYC 248
            ::.|...| .|...|:.:|.|...|||..|||||||||:.||...||.||..:||.:...|.:|.
Human   181 NDVCAQVH-PQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYT 244

  Fly   249 KVSQYVDWIK 258
            ||..|..|||
Human   245 KVVHYRKWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 77/249 (31%)
Tryp_SPc 30..260 CDD:238113 79/251 (31%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.