DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss21

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:309 Identity:90/309 - (29%)
Similarity:134/309 - (43%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPS---------------------------ISRVVNGTDSSVLKYPFVVSLR 48
            |:|::||....|:..|                           .||:|.|.::.:.::|:..|||
  Rat    12 LVVVVAVEVTLQSTSSHVKPVDPEKPELQEANLLSGPCGHRTIPSRIVGGEEAELGRWPWQGSLR 76

  Fly    49 SYDGSHSCGGSIISKHFVMTAAHC--TNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHED--F 109
            .: |:|.||.:::::.:|:|||||  .:..|.| .::|||.........|:.......|.||  .
  Rat    77 VW-GNHLCGATLLNRRWVLTAAHCFQKDNDPFD-WTVQFGELTSRPSLWNLQAYSNRYQIEDIFL 139

  Fly   110 DP--TRQNANDISLLMVEEPFEFDGVSVAPVEL--PALAFAVPQSDAGVEGVLIGWGL--NDTYG 168
            .|  |.|..:||:||.:..|..:... :.|:.|  ....|| .::|..|    .|||.  .|...
  Rat   140 SPKYTEQFPHDIALLKLSSPVTYSNF-IQPICLLNSTYKFA-NRTDCWV----TGWGAIGEDESL 198

  Fly   169 SVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHI-------CGGVDEGGKGQC---------SGDS 217
            .:.:.||||.:.|.::..|.....   .|.:.|       |.|..||||..|         .|||
  Rat   199 PLPNNLQEVQVAIINNTMCNHLFK---KPDFRINIWGDMVCAGSPEGGKDACFAKLTYAAPQGDS 260

  Fly   218 GGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQI 262
            ||||:.|..    |||:|||.| .|.....||||..:|.:.:||:...|
  Rat   261 GGPLVCNQDTVWYQVGVVSWGI-GCGRPNRPGVYTNISHHYNWIRLTMI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 80/257 (31%)
Tryp_SPc 30..260 CDD:238113 81/259 (31%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 80/257 (31%)
Tryp_SPc 58..304 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.