DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Send2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:261 Identity:89/261 - (34%)
Similarity:132/261 - (50%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVILAVTTVGQAAPSI---SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAH 71
            |.:::||:.:: .|.|.|   .|::.|....:.:.|:.||::. ||.|.|||||.|...::||||
  Fly     5 SFLLLLALNSL-SAGPVIRPEERIIGGQPIGIEEAPWQVSIQR-DGKHLCGGSIYSADIIITAAH 67

  Fly    72 CTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVA 136
            |..|:   ...::.|....::.| :||.:..|..||..      .|||:::.:.:|.||.. .|.
  Fly    68 CVQGQ---GYQVRAGSALKNSNG-SVVDVAAIRTHEGL------GNDIAIVRLSKPLEFTN-QVQ 121

  Fly   137 PVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHI 201
            |:.| |.....|.|.|.|.    |||.:..|....| ||.|:|.|.....|     |.|:|. .|
  Fly   122 PIPL-AKTNPPPGSIAFVS----GWGSSSYYSHPID-LQGVNLYIQWPYYC-----GLTEPS-RI 174

  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS--NQIIS 264
            |.|  ..|:..|.|||||||:::.|.||:||...|.||   |..:|..|..:.:||.:  ::|:|
  Fly   175 CAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREWILNAIDEIMS 234

  Fly   265 A 265
            |
  Fly   235 A 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/227 (34%)
Tryp_SPc 30..260 CDD:238113 79/231 (34%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 78/227 (34%)
Tryp_SPc 27..225 CDD:238113 77/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.