DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Phae2

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:127/271 - (46%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAA------PSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVM 67
            |:.|::||| .|.|.:      |. .|||.|..::....|::||:: |.|:|.|..:||:.::::
  Fly     7 LATILLLAV-CVSQGSGLALDQPE-GRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLV 68

  Fly    68 TAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQH---EDFDPTRQNANDISLLMVEEPFE 129
            |||||...| ...|.......:|:..|......|:.|.|   .|.........||.|:.....|.
  Fly    69 TAAHCLANR-NQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFT 132

  Fly   130 FDGVSVAPVELPALAFAVPQSDAGV----EGVLIGWGLNDTYG--SVQDTLQEV-SLKIYSDEEC 187
            :. .:||||:||:         :||    :..|.|||......  |...||||. ::.|.|.:.|
  Fly   133 WT-AAVAPVKLPS---------SGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSC 187

  Fly   188 TSR--HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKV 250
            .:.  ..||.....::|.|...||...|:.||||||:.....:|||||...||.....|.||.:|
  Fly   188 AAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQV 252

  Fly   251 SQYVDWIKSNQ 261
            |.::.||.:||
  Fly   253 SSFITWIAANQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/239 (31%)
Tryp_SPc 30..260 CDD:238113 76/241 (32%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/239 (31%)
Tryp_SPc 32..262 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.