DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRSS48

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:286 Identity:87/286 - (30%)
Similarity:126/286 - (44%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC 72
            ||||:       .||...| ||||.|.|::..::|:.|||. :|.:..||||::|:..::|||||
Human    37 SLSLV-------CGQPVYS-SRVVGGQDAAAGRWPWQVSLH-FDHNFICGGSLVSERLILTAAHC 92

  Fly    73 TNGRPADTLSIQFGVTNISA---MGPNVVG---------IKKIIQHEDFDPTRQNANDISLLMVE 125
                      ||...|..|.   :|...||         :.||:.|..:..|   ..|::||.:.
Human    93 ----------IQPTWTTFSYTVWLGSITVGDSRKRVKYYVSKIVIHPKYQDT---TADVALLKLS 144

  Fly   126 EPFEFDGVSVAPVELPALA--FAVPQSDAGVEGVLIGWG--LNDTYGSVQDTLQEVSLKIYSDEE 186
            ....|.. ::.|:.||::.  .|:|..     ..:.|||  ...:.......|||..:.|...:.
Human   145 SQVTFTS-AILPICLPSVTKQLAIPPF-----CWVTGWGKVKESSDRDYHSALQEAEVPIIDRQA 203

  Fly   187 CTSRHN------GQTDP---KYHICGGVDEGGKGQCSGDSGGPLIYNGQ----QVGIVSWSIKPC 238
            |...:|      ...:|   :..||.|..:..|..|.|||||||..:..    |.|:|||.:: |
Human   204 CEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLE-C 267

  Fly   239 TVAPYPGVYCKVSQYVDWIKSNQIIS 264
            ..: .||||..|..|..||  |..||
Human   268 GKS-LPGVYTNVIYYQKWI--NATIS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/256 (29%)
Tryp_SPc 30..260 CDD:238113 75/258 (29%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 74/256 (29%)
Tryp_SPc 51..288 CDD:238113 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.