DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:274 Identity:75/274 - (27%)
Similarity:129/274 - (47%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNG-RPADTL- 81
            |..:::.::.|::.|||:....:|:.|||. :.||..||.|:||:.::::||||.:| |.:|.. 
Human   595 TCSRSSSALHRIIGGTDTLEGGWPWQVSLH-FVGSAYCGASVISREWLLSAAHCFHGNRLSDPTP 658

  Fly    82 -SIQFGV---TNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPA 142
             :...|:   .|...:.|    :::|:.||.::              .:.|::|      :.|..
Human   659 WTAHLGMYVQGNAKFVSP----VRRIVVHEYYN--------------SQTFDYD------IALLQ 699

  Fly   143 LAFAVPQS-----------------DAGVEGVLIGWGLN---DTYGSVQDTLQEVSLKIYSDEEC 187
            |:.|.|::                 .:|.:..:.|||..   |..||:  .||:..:::.....|
Human   700 LSIAWPETLKQLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSL--VLQQAEVELIDQTLC 762

  Fly   188 TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI----YNGQQV--GIVSW---SIKPCTVAPY 243
            .|.:...|...  :|.|:..|.:..|.|||||||.    .:|:.:  |||||   |.:|    .:
Human   763 VSTYGIITSRM--LCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRP----NF 821

  Fly   244 PGVYCKVSQYVDWI 257
            ||||.:||.:|.||
Human   822 PGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 72/262 (27%)
Tryp_SPc 30..260 CDD:238113 73/263 (28%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.