DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and PRSS53

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:322 Identity:69/322 - (21%)
Similarity:118/322 - (36%) Gaps:86/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVILAVTTV------------GQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKH 64
            ::::|..||            ||..|...:...| ::...::|:..|:|. .|:|.|.||:::..
Human     8 VLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEG-NTVPGEWPWQASVRR-QGAHICSGSLVADT 70

  Fly    65 FVMTAAHCTNGRPADTL---SIQFGVTNISAMGPNV--VGIKKIIQHEDFDPTRQNANDISLLMV 124
            :|:|||||.....|..|   |:..|......:.|..  ||:..:.....::...| .:|::||.:
Human    71 WVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQ-GSDLALLQL 134

  Fly   125 EEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGS-------------------- 169
            ..|     .:..|:.||..|...|   .|......||..:.:.|.                    
Human   135 AHP-----TTHTPLCLPQPAHRFP---FGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSA 191

  Fly   170 -------------------------VQDTLQEVSLKIYSDEECT-------SRHNGQTDPKYHIC 202
                                     ...||:.:.|::.|...|.       .||.........:|
Human   192 PNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLC 256

  Fly   203 GGVDEGGKGQCSGDSGGPLIY---NGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            ||...|.:|.|.||||||::.   :|.  |.||:|:: ..|.....|.:....:.:..|:::
Human   257 GGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFA-SSCAQEDAPVLLTNTAAHSSWLQA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 62/289 (21%)
Tryp_SPc 30..260 CDD:238113 63/292 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 62/284 (22%)
Tryp_SPc 43..314 CDD:214473 61/281 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.