DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG11911

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:283 Identity:90/283 - (31%)
Similarity:139/283 - (49%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVG--------QAAPSISR--VVNGTDSSVLKYPFVVSLRS--YDGSHSCGGS 59
            ::::|::.|.....|        :..||.:.  |:|||::.....|::|||.:  ...||.|||:
  Fly     4 ITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGT 68

  Fly    60 IISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNAN------- 117
            :|:|.:::|||||        :|...|::.|:.:... ..:.::.|....|..|.:..       
  Fly    69 LINKDWIVTAAHC--------ISEPVGMSIIAGLHTR-AEVDELTQQRQVDFGRVHEKYTGGVGP 124

  Fly   118 -DISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTY-GSVQDTLQEVSLK 180
             ||:||.|.|.|.|: ..|.|..||:.    .|...| |..|.|||...:| .|...|||.|:.:
  Fly   125 YDIALLHVNESFIFN-EWVQPATLPSR----EQVHEG-ETHLYGWGQPKSYIFSGAKTLQTVTTQ 183

  Fly   181 IYSDEECTSRHNGQTDP--KYHICGGVDEGGKGQCSGDSGGPLIYN-----GQQVGIVSWSIKPC 238
            |.:.||| .....::.|  :.:||....:..|..|:|||||||:..     .:.:|||||...||
  Fly   184 ILNYEEC-KEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPC 247

  Fly   239 TVAPYPGVYCKVSQYVDWIKSNQ 261
            .:|..|.:|.|||.|:|||.:.|
  Fly   248 GLANMPSIYTKVSAYIDWITNIQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 82/247 (33%)
Tryp_SPc 30..260 CDD:238113 84/247 (34%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 84/247 (34%)
Tryp_SPc 37..266 CDD:214473 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.