DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG11912

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:131/283 - (46%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSI-------SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70
            ||.|:.....:|.|:       .|::||.:::..:.|::|||::...||.|.||::.:..::|||
  Fly     6 VIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAA 70

  Fly    71 HCTNGRPADTLSIQFGVTNISAMGPNVVGIKKI-----IQHEDF----DPTRQNANDISLLMV-- 124
            ||........::.....|:     ...|.|:|.     :.||::    .|     |||.|:::  
  Fly    71 HCLTYNQGQAVAGAHSRTD-----QENVQIRKFTNAQYVIHENYGGGVGP-----NDIGLILLKE 125

  Fly   125 EEPFEFDGVS------VAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYS 183
            |:.|:.:.|:      |:.|.||:..|     ....:|.|.||| .|..|.:...||::...|..
  Fly   126 EDAFDLNAVARDGSNPVSAVSLPSKTF-----QGTSDGYLYGWG-RDNSGLLPLNLQKLDAIIVD 184

  Fly   184 DEEC-----TSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI-----YNGQQVGIVSWSIKPC 238
            ..||     ::....:|:...|..|..|    |.|:|||||||:     ...:.:|||||...||
  Fly   185 YNECKAALPSNNSLAETNVCTHTPGKAD----GSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPC 245

  Fly   239 TVAPYPGVYCKVSQYVDWIKSNQ 261
            ....||.||..||.::.||..|:
  Fly   246 LSTTYPSVYTSVSSFLPWIDENR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/254 (29%)
Tryp_SPc 30..260 CDD:238113 75/256 (29%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/254 (29%)
Tryp_SPc 30..267 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.