DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG1304

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:261 Identity:90/261 - (34%)
Similarity:139/261 - (53%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVILAVTTVGQAAPSIS-RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC- 72
            |.:::||| .|..|..|:: |||.|.|:...::|..||||: .|||||||||:|:::|:||||| 
  Fly    12 SFLLLLAV-PVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRN-AGSHSCGGSILSRNYVLTAAHCV 74

  Fly    73 ----TNGR----PADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFE 129
                :||.    .|:..:|:.| :|....|..:|.:.::|.||::.   ...||::||.:|.|..
  Fly    75 TNQDSNGNSVPIAAERFTIRAG-SNDRFSGGVLVQVAEVIVHEEYG---NFLNDVALLRLESPLI 135

  Fly   130 FDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQ 194
            . ..|:.|::||     ...:.|.|:.::.|||.....|.:...||..:||..|.|.|.......
  Fly   136 L-SASIQPIDLP-----TADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWG 194

  Fly   195 TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            ...:..:   :.|...|.|:||||||.:||.|.||:..:....|..: ||..|.:|..:.:|||:
  Fly   195 VQSELCL---IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTS-YPDGYARVYYHNEWIKN 255

  Fly   260 N 260
            |
  Fly   256 N 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/236 (33%)
Tryp_SPc 30..260 CDD:238113 81/238 (34%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 79/236 (33%)
Tryp_SPc 32..256 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.