DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss53

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:282 Identity:69/282 - (24%)
Similarity:119/282 - (42%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTV----------GQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65
            |:::.||..:          ||..|.......| ::...::|:..|:|. .|.|.|.||:::..:
Mouse     9 LLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEG-NTLPGEWPWQASVRR-QGVHICSGSLVADTW 71

  Fly    66 VMTAAHCTNGRPADTL---SIQFGVTNISAMGPNV--VGIKKIIQHEDFDPTRQNANDISLLMVE 125
            |:|||||........|   |:..|........|..  ||:..:...:.::...| .:|::||.:.
Mouse    72 VLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQ-GSDLALLQLT 135

  Fly   126 EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSR 190
            .|     .....:.||...:..|   .|......||..|.:  .|..||:.:.|::.|...|...
Mouse   136 HP-----TVQTTLCLPQPTYHFP---FGASCWATGWDQNTS--DVSRTLRNLRLRLISRPTCNCL 190

  Fly   191 HNGQTDPKYH------------ICGGVDEGGKGQCSGDSGGPLIY---NGQ--QVGIVSWSIKPC 238
            :|     :.|            :|||...|.:|.|.||||||::.   :|.  ||||:|::.| |
Mouse   191 YN-----RLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSK-C 249

  Fly   239 TVAPYPGVYCKVSQYVDWIKSN 260
            .....|.:...::.:..|::::
Mouse   250 AQEDTPVLLTDMAVHSSWLQAH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 62/249 (25%)
Tryp_SPc 30..260 CDD:238113 63/251 (25%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 4/19 (21%)
Tryp_SPc 45..271 CDD:238113 62/243 (26%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.