DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG33159

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:120/241 - (49%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGV 87
            ::.|.:|:|.|.::::.:.|::|.||. :|...||||:||...|::||||..|...:..::..|.
  Fly    19 SSSSKTRIVGGKETTISEVPYLVYLRQ-NGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGA 82

  Fly    88 TNISAMGPNVVGIKKIIQHEDFDPTRQNAN---DISLLMVEE-----PFEFDGVSVAPVELPALA 144
            :.:....|.|..:  ::.|.  .|:....|   |::||.::|     |.:.  .:::|...|   
  Fly    83 SRLDQEAPVVRNV--VMFHT--SPSYSATNFDMDVALLQLQEVVVLTPGKV--ATISPCRNP--- 138

  Fly   145 FAVPQSDAGVEGVLIGWGL-NDTYGSVQDTLQEVSLKIYSDEECTSRHNGQ---TDPKYHICGGV 205
               |:.:|...  :.|||: .:......:.::...:::....||...::|.   :|..  :|..|
  Fly   139 ---PEGNAYAR--ISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSM--LCAAV 196

  Fly   206 DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS 251
             .|.:..|||||||||:|.||..|||||.. .|....:||||..|:
  Fly   197 -RGLRDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 68/235 (29%)
Tryp_SPc 30..260 CDD:238113 67/234 (29%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 68/235 (29%)
Tryp_SPc 26..251 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.