DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG31681

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:121/266 - (45%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAPS-ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70
            |.||::|.:|........|. ..|:|.|:...:...|:.||::: :..|.|||.|.|...::|||
  Fly     5 LLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVIYSDRAILTAA 68

  Fly    71 HCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSV 135
            ||.:......||::.| ::..:.|..|:.:.|.|.|..:.|...|..||::|::|.|....|.  
  Fly    69 HCLSNVTVTDLSVRAG-SSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT-- 130

  Fly   136 APVELPALAFAVPQSDAGVEGVLI---GWGLNDTYGS-VQDTLQEVSLKIYSDEECTSRHNGQTD 196
              |:...||...|     |.|.::   |||......| :...||.|.:.|.:..:|...:.....
  Fly   131 --VKKIPLAEQTP-----VAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNI 188

  Fly   197 PKYHICGGVDEGGKGQ----CSGDSGGPLIY-----NGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252
            ....||      ..||    |.||||||||.     :.|.:|:|||. ..|  ...||||..::.
  Fly   189 TIDMIC------ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGC--GTNPGVYEDIAF 244

  Fly   253 YVDWIK 258
            :.:|||
  Fly   245 FHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/240 (30%)
Tryp_SPc 30..260 CDD:238113 73/242 (30%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 71/240 (30%)
Tryp_SPc 29..250 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.