DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG31267

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:240 Identity:74/240 - (30%)
Similarity:124/240 - (51%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92
            ||:|.|.:|.||..|::|||::..|:|.|.||||...:|:|||.|..|...:  ::|...|..:.
  Fly    43 SRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKN--NVQVVTTTYNH 105

  Fly    93 MGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD----GVSVAPVELPALAFAVPQSD 151
            .|..  :..::.|:.|.:||....: |||:|:.....|::|    .:::||:|         ...
  Fly   106 WGSEGWIYSVEDIVMHCNFDSPMYH-NDIALIKTHALFDYDDVTQNITIAPLE---------DLT 160

  Fly   152 AGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKY-HICGGVDEGGKGQCSG 215
            .|....:.|:|..:..|.....||::.:...:.|:|.:.:.|..|... |:| .|.:.|.|.|.|
  Fly   161 DGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLC-AVGKVGAGACHG 224

  Fly   216 DSGGPLI-YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            |:|||:: ..|:.||:.:|.: ||... :|.|:.::|.|..||.|
  Fly   225 DTGGPIVDSRGRLVGVGNWGV-PCGYG-FPDVFARISFYYSWIIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/235 (30%)
Tryp_SPc 30..260 CDD:238113 72/238 (30%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/235 (30%)
Tryp_SPc 45..268 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.