DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk15

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:261 Identity:83/261 - (31%)
Similarity:124/261 - (47%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRP 77
            ::||...:..||....:|:.|.:......|:.|:|.. .|..:||..:||..:|:|||||    .
Mouse     3 LLLAFVLLVSAAQDGDKVLEGEECVPHSQPWQVALFE-RGRFNCGAFLISPRWVLTAAHC----Q 62

  Fly    78 ADTLSIQFGVTNISAM-GPNVV-GIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVEL 140
            ...:.::.|..|:... ||..: .:.:||.|..:: .|.:.:||.||.:.:|...... |.||.|
Mouse    63 TRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYE-ARTHRHDIMLLRLFKPARLTAY-VRPVAL 125

  Fly   141 PALAFAVPQSDAGVEGVLIGWGL-----------NDTYGSVQDTLQEVSLKIYSDEECTSRHNGQ 194
            |.....:     |.:.|:.||||           ..::..:.|||...::.|.|:..|...:.|:
Mouse   126 PRRCPLI-----GEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDYPGR 185

  Fly   195 TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            ..|.. :|.||:.||...|.|||||||:..|...|||||...||.....||||.||..|::||..
Mouse   186 VLPTM-VCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWIWE 249

  Fly   260 N 260
            |
Mouse   250 N 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/240 (32%)
Tryp_SPc 30..260 CDD:238113 78/242 (32%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.