DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prtn3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:241 Identity:74/241 - (30%)
Similarity:116/241 - (48%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APSISRVVNGTDSSVLKYPFVVSL---RSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQF 85
            |...|::|.|.::.....|:|.||   || .|||.|||::|...||:|||||........:::..
  Rat   192 AVQASKIVGGHEARPHSRPYVASLQLSRS-PGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVL 255

  Fly    86 GVTNISAMGP--NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVP 148
            |..::.:..|  ....|.::.:: :::| .:..||:.||.:..|... |..||...||....::.
  Rat   256 GAHDLLSSEPEQQKFTITQVFEN-NYNP-EETLNDVLLLQLNRPASL-GKQVAVASLPQQDQSLS 317

  Fly   149 QSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQC 213
            |   |.:.:.:|||...|.......|.|:::.:.:  .....||        :|..|.....|.|
  Rat   318 Q---GTQCLAMGWGRLGTRAPTPRVLHELNVTVVT--FLCREHN--------VCTLVPRRAAGIC 369

  Fly   214 SGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKS 259
            .||||||||.||...|:.|:.|:.|....:|..:.:||.||:||.|
  Rat   370 FGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 69/232 (30%)
Tryp_SPc 30..260 CDD:238113 72/235 (31%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.