DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CG14780

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:110/250 - (44%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLR------SYDGSHSCGGSIISKHFVMTAAHCTNG------RPADT 80
            ||::||:.:...:...:||:|      ::...|.|||::|:...|:|||||...      |.|..
  Fly    31 SRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASE 95

  Fly    81 LSIQFGVTN--ISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEE--PFEFDG---VSVAPV 138
            ..:..|..|  ....|..|..:..:.....|.|.... :|:.:|.:..  |....|   ::|||:
  Fly    96 FVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMR-DDVGILFLRTGLPMSPGGGVHLTVAPI 159

  Fly   139 ELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICG 203
            :|     |...:..|....:.|||..: ..|:.:.|...::.....:.|...:.....|.. :|.
  Fly   160 QL-----AGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQTCRMIYRSGLLPGM-MCA 217

  Fly   204 GVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |..:||...|.|||||||::.|:.||:|||.. .|.....||||..|..|..||:
  Fly   218 GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGVYVDVEYYRQWIE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/246 (27%)
Tryp_SPc 30..260 CDD:238113 68/247 (28%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 67/246 (27%)
Tryp_SPc 33..271 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.