DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Prss30

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:272 Identity:83/272 - (30%)
Similarity:124/272 - (45%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQAAPSI-------SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC-TNGRP 77
            |...||:       .::|.|.|:...::|:.|||...:..|.||||:|.:.:|:||||| .....
Mouse    58 GDILPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLN 122

  Fly    78 ADTLSIQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEEPF---EFDGVSVAP 137
            .....::.|...:|.:.|:  :|.::.|..|..:.....::.||:|:.::.|.   :|     .|
Mouse   123 PSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQF-----TP 182

  Fly   138 VELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYH-- 200
            |.|||   |......|....:.|||.... ..:...|||:::.:...|:|        :..||  
Mouse   183 VCLPA---AQTPLTPGTVCWVTGWGATQE-RDMASVLQELAVPLLDSEDC--------EKMYHTQ 235

  Fly   201 --------------ICGGVDEGGKGQCSGDSGGPLI----YNGQQVGIVSWSIKPCTVAPY-PGV 246
                          :|.|..||.|..|.|||||||:    .:..||||.||.| .| ..|| |||
Mouse   236 GSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI-GC-ARPYRPGV 298

  Fly   247 YCKVSQYVDWIK 258
            |.:|..|||||:
Mouse   299 YTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/254 (31%)
Tryp_SPc 30..260 CDD:238113 80/256 (31%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.