DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk8

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:257 Identity:77/257 - (29%)
Similarity:120/257 - (46%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSH-SCGGSIISKHFVMTAAHCTN 74
            |:.:|.....|......|:::.|.:......|:..:|  :.|.. .|||.::...:|:|||||..
  Rat    14 LLFLLMGAWAGLTRAQGSKILEGQECKPHSQPWQTAL--FQGERLVCGGVLVGDRWVLTAAHCKK 76

  Fly    75 GRPADTLSIQFGVTNISAMG--PNVVGIKKIIQHEDFDPT--RQNANDISLLMVEEPFEFDGVSV 135
                |..|::.|..::....  ...:.:.:.|||..|:.:  ..:::||.|:.::..... |..|
  Rat    77 ----DKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANL-GDKV 136

  Fly   136 APVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQD----TLQEVSLKIYSDEECTSRHNGQTD 196
            .|:||..|...|     |.:.::.|||   |..|.|:    ||....:||||..:|...:.|:. 
  Rat   137 KPIELANLCPKV-----GQKCIISGWG---TVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKI- 192

  Fly   197 PKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            .:..:|.| ...|...|.|||||||:.||...||.||...||.....||||.|:.:|.:|||
  Rat   193 TEGMVCAG-SSNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/236 (30%)
Tryp_SPc 30..260 CDD:238113 73/238 (31%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.