DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk14

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:124/260 - (47%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSH-SCGGSIISKHFVMTAA 70
            |.|:::..|||..|  .:....:::.|........|:.|:|::..|.. .|||.::|..:|:|||
  Rat    63 LLLTILQALAVAIV--QSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQWVITAA 125

  Fly    71 HCTNGRPADTLSIQFGVTNIS--AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD-G 132
            ||  .||  .|.:..|..|:.  .....|:.:.:.:.|..:.| :.:.||:.||.::...... .
  Rat   126 HC--ARP--LLHVALGKHNLRRWEATQQVLRVVRQVPHPQYRP-QAHDNDLMLLKLQRKVRLGRA 185

  Fly   133 VSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGS----VQDTLQEVSLKIYSDEECTSRHNG 193
            |...||   |.:.|.|.:...|.    |||   |..|    ....||.|::.|..::.|...:.|
  Rat   186 VRTIPV---ARSCASPGTPCRVS----GWG---TTASPIVRYPTALQCVNVNIMPEQVCHRAYPG 240

  Fly   194 QTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
             |.....:|.||.||||..|.|||||||:..||..|:|||.::.|.:..|||||..:..|..||:
  Rat   241 -TITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWIQ 304

  Fly   259  258
              Rat   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/235 (31%)
Tryp_SPc 30..260 CDD:238113 76/237 (32%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.