DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:243 Identity:79/243 - (32%)
Similarity:123/243 - (50%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC--TNGRPADTLSIQFGVTNIS 91
            |:|.||.:...::|:..||: :||||.||.::||..::::||||  |:..|: ..:..||.|   
  Rat   212 RIVGGTSAEEGEWPWQSSLQ-WDGSHRCGATLISNTWLVSAAHCFRTHKDPS-RWTASFGAT--- 271

  Fly    92 AMGPNV-VGIKKIIQHEDFD-PTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGV 154
            ...|.: .||::||.||.:: |:..  .||:|:.:..|..... :|..|.||.   |..:...|.
  Rat   272 LQPPKLTTGIRRIIVHEKYNYPSHD--YDIALVELSRPVPCTN-AVHKVCLPD---ANHEFQPGQ 330

  Fly   155 EGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECT--SRHNGQTDPKYHICGGVDEGGKGQCSGDS 217
            ...:.|:|.....|..|:.|::|.:.....:.|.  ..:||...|:. :|.|..:|.|..|.|||
  Rat   331 RMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNGAITPRM-LCAGFLKGEKDACQGDS 394

  Fly   218 GGPLIYNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260
            ||||:....:     .|:|||. ..|.....||||.:|:.:.|||.||
  Rat   395 GGPLVTPDVRDVWYLAGVVSWG-DECGQPNKPGVYTRVTAFRDWITSN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/238 (32%)
Tryp_SPc 30..260 CDD:238113 76/240 (32%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 76/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.