DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Elane

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:264 Identity:82/264 - (31%)
Similarity:130/264 - (49%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNQDLSLSLIVILAVTTVGQAAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFV 66
            |||.|:..|:.:|.|      .|:: |.:|.|..:....:||:|||:. .|.|.||.::|:::||
  Rat    11 SNQTLASMLLALLLV------CPALASEIVGGRPAQPHAWPFMVSLQR-RGGHFCGATLIARNFV 68

  Fly    67 MTAAHCTNGRPADTLSIQFGVTNISAMGP--NVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFE 129
            |:||||.|||...::.:..|..::....|  .:..:::|.:: .|||:|. .|||.::.:.....
  Rat    69 MSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDPSRL-LNDIVIIQLNGSAT 131

  Fly   130 FDGVSVAPVELPALAFAVPQSDAGVEG----VLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSR 190
            .: .:|...||||       ...||..    |.:|||...|...:...|||:::.:.:: .|..|
  Rat   132 IN-ANVQVAELPA-------QGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTN-LCRRR 187

  Fly   191 HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
            .|        :|..|.....|.|.|||||||:.|....||.|:....|....||..:..|:::.|
  Rat   188 VN--------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFAD 244

  Fly   256 WIKS 259
            ||.|
  Rat   245 WINS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/233 (30%)
Tryp_SPc 30..260 CDD:238113 73/236 (31%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 70/233 (30%)
Tryp_SPc 33..249 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.