DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk1c3

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:262 Identity:87/262 - (33%)
Similarity:131/262 - (50%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |.|.:.|::..:..|.|..||||.|........|:.|::.:.|   .|||.:|...:|:|||||.
  Rat     4 LILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVINED---LCGGVLIDPSWVITAAHCY 65

  Fly    74 NGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDP------TRQ---NANDISLLMVEEPFE 129
                :|...:..|..|:|....:.: :.:..:|.|:.|      ||:   .:||:.||.:.||.:
  Rat    66 ----SDNYHVLLGQNNLSEDVQHRL-VSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSEPAD 125

  Fly   130 F-DGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHN 192
            . |||.|  ::||     ..:...|...::.||| .|.:.....|.||.|::.:.|:|:|...:.
  Rat   126 ITDGVKV--IDLP-----TKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAYK 183

  Fly   193 GQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            .: ||  ..:|.|..||||..|.||||||||.:|...||.||...||.....||:|.|:.::..|
  Rat   184 EKVTD--LMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSW 246

  Fly   257 IK 258
            ||
  Rat   247 IK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/239 (33%)
Tryp_SPc 30..260 CDD:238113 80/241 (33%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 78/239 (33%)
Tryp_SPc 25..250 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.