DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk7

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:257 Identity:74/257 - (28%)
Similarity:121/257 - (47%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |::::.||:.|.||.    .|:::|.......:|:.|:|...|..| |||.::.:.:|:|||||.
  Rat     9 LTVLLSLALETAGQG----ERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLVGESWVLTAAHCK 68

  Fly    74 NGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPV 138
            .|:    .::..|...|.......:...:..:|..:. ||.:.|||.|:.:::|.:... .|..|
  Rat    69 MGQ----YTVHLGSDKIEDQSAQRIKASRSFRHPGYS-TRTHVNDIMLVKMDKPVKMSD-KVQKV 127

  Fly   139 ELPALAFAVPQSDAGVEGVLIGWGLND----TYGSVQDTLQEVSLKIYSDEECTSRHN---GQTD 196
            :||...     ...|....:.|||...    |:.|   .|....:|:.|.:||...:.   |:| 
  Rat   128 KLPDHC-----EPPGTLCTVSGWGTTTSPDVTFPS---DLMCSDVKLISSQECKKVYKDLLGKT- 183

  Fly   197 PKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
               .:|.|:.:.....|:|||||||:.|....|:|||...||.....||||.:|.:|..|::
  Rat   184 ---MLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/234 (29%)
Tryp_SPc 30..260 CDD:238113 67/236 (28%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 67/233 (29%)
Tryp_SPc 26..244 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.