DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Hpn

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:262 Identity:94/262 - (35%)
Similarity:132/262 - (50%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC--TNGRPADTLSI 83
            |:....:.|:|.|.|||:.::|:.|||| |||:|.||||::|..:|:|||||  ...|......:
  Rat   195 GRRKLPVDRIVGGQDSSLGRWPWQVSLR-YDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRV 258

  Fly    84 QFGVTNISAMGPNVV--GIKKIIQHEDF----DPT-RQNANDISLLMVEEPF---EFDGVSVAPV 138
            ..|.  ::...|:.|  |::.:|.|..:    ||| .:|:|||:|:.:....   |:    :.||
  Rat   259 FAGA--VARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEY----IQPV 317

  Fly   139 ELPALAFAVPQSDAGVEG---VLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSR--HNGQTDPK 198
            .|||...|:      |:|   .:.|||....||.....|||..:.|.|:|.|.|.  :..|..||
  Rat   318 CLPAAGQAL------VDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPK 376

  Fly   199 YHICGGVDEGGKGQCSGDSGGPLIYNG--------QQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
            . .|.|..|||...|.||||||.:...        :..|||||. ..|.:|..||||.||..:.:
  Rat   377 M-FCAGYPEGGIDACQGDSGGPFVCEDRISGTSRWRLCGIVSWG-TGCALARKPGVYTKVIDFRE 439

  Fly   256 WI 257
            ||
  Rat   440 WI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 91/252 (36%)
Tryp_SPc 30..260 CDD:238113 92/253 (36%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 1/4 (25%)
Tryp_SPc 204..441 CDD:238113 90/251 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.