DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK9

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:223 Identity:62/223 - (27%)
Similarity:102/223 - (45%) Gaps:45/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNI-SAMGPNVVGIKKIIQHEDFDP-------- 111
            ||.::||..:::|||||.  :|  .|.::.|..:: ...||     :::.:..||.|        
Human    48 CGATLISDRWLLTAAHCR--KP--YLWVRLGEHHLWKWEGP-----EQLFRVTDFFPHPGFNKDL 103

  Fly   112 -TRQNANDISLLMVE---------EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LND 165
             ...:.:||.|:.:.         :|.......|:|               |::.::.||| ::.
Human   104 SANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSP---------------GMQCLISGWGAVSS 153

  Fly   166 TYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGI 230
            .......|||..::.|..::.|...:.|...... :|.|:.|||:|.|.|||||||:.||...|:
Human   154 PKALFPVTLQCANISILENKLCHWAYPGHISDSM-LCAGLWEGGRGSCQGDSGGPLVCNGTLAGV 217

  Fly   231 VSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            ||...:||:....|.||..|..|:|||:
Human   218 VSGGAEPCSRPRRPAVYTSVCHYLDWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 60/220 (27%)
Tryp_SPc 30..260 CDD:238113 62/223 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.