DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK13

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:276 Identity:88/276 - (31%)
Similarity:127/276 - (46%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVI-LAVTTVGQAAPSISRVVNGTDSSVL----------KYPFVVSLRSYDGSHSCGGSIIS 62
            |:|::. |.:...|..:...|:|:|...:|..          ..|:..:| ...|...|||.::.
Human     4 LALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAAL-LVQGRLLCGGVLVH 67

  Fly    63 KHFVMTAAHCTNGRPADTLSIQFGVTNISAM--GPNVVGIKKIIQHEDF--DPTRQN-ANDISLL 122
            ..:|:|||||..    :.|.:..|...:..:  |..|..:...|.|.::  .||..| .:||.||
Human    68 PKWVLTAAHCLK----EGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLL 128

  Fly   123 MVEEPFEFDGVSVAPVELPALAFAVPQS-----DAGVEGVLIGWGLNDTYGSVQ----DTLQEVS 178
            .::          :||:|......:|.|     ..|....:.|||   |..|.|    .|||..:
Human   129 ELQ----------SPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWG---TTTSPQVNYPKTLQCAN 180

  Fly   179 LKIYSDEECTSRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAP 242
            :::.|||||...:.|: ||..  :|.|..||||..|.|||||||:.|....|||||...||....
Human   181 IQLRSDEECRQVYPGKITDNM--LCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPD 243

  Fly   243 YPGVYCKVSQYVDWIK 258
            .||||.:||:||.||:
Human   244 RPGVYTRVSRYVLWIR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 81/252 (32%)
Tryp_SPc 30..260 CDD:238113 83/254 (33%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.