DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and KLK5

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:269 Identity:73/269 - (27%)
Similarity:119/269 - (44%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNQDLSLSLIVILAVTTVGQAA---PSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKH 64
            |||||...         .|:.|   .|.||::||:|..:...|:..:|........||..::...
Human    46 SNQDLGAG---------AGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQ 101

  Fly    65 FVMTAAHCTNGRPADTLSIQFGVTNISAM---GPNVVGIKKIIQHEDFDPTRQNANDISLLMVE- 125
            :::|||||..    ....::.|..::|.:   |..:....|.|.|..:... .::||:.|:.:. 
Human   102 WLLTAAHCRK----KVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHP-GHSNDLMLIKLNR 161

  Fly   126 --EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ----DTLQEVSLKIYSD 184
              .|.:    .|.|:.:.:..     ..||.:.::.|||   |..|.|    ..||.:::.:.|.
Human   162 RIRPTK----DVRPINVSSHC-----PSAGTKCLVSGWG---TTKSPQVHFPKVLQCLNISVLSQ 214

  Fly   185 EECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCK 249
            :.|...:..|.|... .|.| |:.|:..|.||||||::.||...|:|||...||.....||||..
Human   215 KRCEDAYPRQIDDTM-FCAG-DKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTN 277

  Fly   250 VSQYVDWIK 258
            :.::..||:
Human   278 LCKFTKWIQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 62/237 (26%)
Tryp_SPc 30..260 CDD:238113 63/239 (26%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 10/30 (33%)
Tryp_SPc 66..285 CDD:214473 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.