DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk6

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus


Alignment Length:265 Identity:75/265 - (28%)
Similarity:126/265 - (47%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSH-SCGGSIISKH 64
            ||:.:.|:|.|::..:..:..|     .:||:|.......:||..:|  |...| .|||.:|...
Mouse     5 MLTMKMLALCLVLAKSAWSEEQ-----EKVVHGGPCLKDSHPFQAAL--YTSGHLLCGGVLIDPQ 62

  Fly    65 FVMTAAHCTNGRPADTLSIQFGVTNI--SAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEP 127
            :|:|||||.  :|  .|.:..|..|:  :......:.:.:.|.|..::|...: |||.::.::.|
Mouse    63 WVLTAAHCK--KP--NLQVILGKHNLRQTETFQRQISVDRTIVHPRYNPETHD-NDIMMVHLKNP 122

  Fly   128 FEFDGVSVAPVELPALAFAVPQSDAGVEG---VLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS 189
            .:| ...:.|:.|        ::|...|.   .::|||..:. |...||:|...:.:...|:|..
Mouse   123 VKF-SKKIQPLPL--------KNDCSEENPNCQILGWGKMEN-GDFPDTIQCADVHLVPREQCER 177

  Fly   190 RHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
            .:.|:..... :|.|..:.|...|.|||||||:..|:..|:|||...||.....||||..|..::
Mouse   178 AYPGKITQSM-VCAGDMKEGNDSCQGDSGGPLVCGGRLRGLVSWGDMPCGSKEKPGVYTDVCTHI 241

  Fly   255 DWIKS 259
            .||::
Mouse   242 RWIQN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/233 (29%)
Tryp_SPc 30..260 CDD:238113 69/236 (29%)
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.