DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and St14

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:247 Identity:82/247 - (33%)
Similarity:125/247 - (50%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC----TNGRPAD-TLSIQF-G 86
            :|||.||::...::|:.|||.:....|.||.|:||..::::||||    .|.:.:| |:...| |
Mouse   633 ARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLG 697

  Fly    87 V---TNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVP 148
            :   :..||.|...:.:|:||.|..|:....: .||:||.:|:..|:..| |.|:.||......|
Mouse   698 LLDQSKRSASGVQELKLKRIITHPSFNDFTFD-YDIALLELEKSVEYSTV-VRPICLPDATHVFP 760

  Fly   149 QSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQC 213
               ||....:.|||.....|:....||:..:::.:...|......|..|:. :|.|...||...|
Mouse   761 ---AGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLMPQQITPRM-MCVGFLSGGVDSC 821

  Fly   214 SGDSGGPLI---YNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260
            .|||||||.   .:|:  |.|:|||. :.|.....||||.::....||||.:
Mouse   822 QGDSGGPLSSAEKDGRMFQAGVVSWG-EGCAQRNKPGVYTRLPVVRDWIKEH 872

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/241 (33%)
Tryp_SPc 30..260 CDD:238113 81/243 (33%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 81/243 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.