DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and CFD

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:271 Identity:71/271 - (26%)
Similarity:125/271 - (46%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQ-----AAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMT 68
            |:::|:|.....|:     |||...|::.|.::.....|::.|:: .:|:|.|||.::::.:|::
Human     7 LAVLVLLGAAACGEEAWAWAAPPRGRILGGREAEAHARPYMASVQ-LNGAHLCGGVLVAEQWVLS 70

  Fly    69 AAHCTNGRPADTLSIQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVEE----- 126
            ||||........:.:..|..::|...|:  :..:.:.:.|.|..|...: :|:.||.:.|     
Human    71 AAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTID-HDLLLLQLSEKATLG 134

  Fly   127 ------PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDE 185
                  |::.....|||..|..:|               |||:.:..|...|:||.|.|.:....
Human   135 PAVRPLPWQRVDRDVAPGTLCDVA---------------GWGIVNHAGRRPDSLQHVLLPVLDRA 184

  Fly   186 ECTSR--HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYC 248
            .|..|  |:|....:. :|  .:...:..|.|||||||:..|...|:|:...:.|.....||:|.
Human   185 TCNRRTHHDGAITERL-MC--AESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYT 246

  Fly   249 KVSQYVDWIKS 259
            :|:.|..||.|
Human   247 RVASYAAWIDS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 61/242 (25%)
Tryp_SPc 30..260 CDD:238113 63/245 (26%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 61/242 (25%)
Tryp_SPc 33..258 CDD:238113 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.