DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk1b16

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_032480.1 Gene:Klk1b16 / 16615 MGIID:891982 Length:261 Species:Mus musculus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:127/272 - (46%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVILAVTTVG-QAAPSI-SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            ||:.||::..| .|||.: ||:|.|........|:.|:: .|...|.|||.::.:::|:|||||.
Mouse     4 LILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAV-YYHKEHICGGVLLDRNWVLTAAHCY 67

  Fly    74 NGRPADTLSIQFGVTNISAMGPNVVG--IKKIIQHEDFD----------PTRQNANDISLLMVEE 126
                .|...:..|...:....|:...  :.|...|..|:          |....:||:.||.:.:
Mouse    68 ----VDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSK 128

  Fly   127 PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSR 190
            |.:...| |.|::||.   ..|:.|:..  ::.||| :..|.....|.||.:..|:..:|.|...
Mouse   129 PADITDV-VKPIDLPT---KEPKLDSTC--LVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKA 187

  Fly   191 HNGQ-TDPKYHICGGVDEG-GKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQY 253
            :..: ||  ..:| .::.| .||.|.||||||||.:|...|.||....||.:.....:|..:.::
Mouse   188 YLLKVTD--VMLC-TIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKF 249

  Fly   254 VDWIKSNQIISA 265
            ..|||...:.:|
Mouse   250 NSWIKDTMMKNA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 67/242 (28%)
Tryp_SPc 30..260 CDD:238113 69/244 (28%)
Klk1b16NP_032480.1 Tryp_SPc 25..256 CDD:238113 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.