DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and Klk1b22

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:262 Identity:82/262 - (31%)
Similarity:126/262 - (48%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73
            |.|.:.|::..:..|.|..||::.|........|:.|::...| .:.|||.::.:::|:|||||.
Mouse     4 LILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLD-EYLCGGVLLDRNWVLTAAHCY 67

  Fly    74 NGRPADTLSIQFGVTNISAMGPNVVG--IKKIIQHEDFD-------PTRQN-ANDISLLMVEEPF 128
            .    |..:|..|...:....|:...  :.|...|.||:       ||..: :||:.||.:.:|.
Mouse    68 E----DKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPA 128

  Fly   129 EFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHN 192
            :...| |.|::||     ..:...|...:..||| :|.......:.||.||:|::.:|.|...|.
Mouse   129 DITDV-VKPIDLP-----TTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHI 187

  Fly   193 GQ-TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            .: ||  ..:|.|...|||..|.||||||||.:|...||.||...||.....|.:|.|:.::..|
Mouse   188 LKVTD--VMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSW 250

  Fly   257 IK 258
            ||
Mouse   251 IK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/239 (31%)
Tryp_SPc 30..260 CDD:238113 75/241 (31%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 73/239 (31%)
Tryp_SPc 25..254 CDD:238113 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.