DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12951 and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:265 Identity:81/265 - (30%)
Similarity:137/265 - (51%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLIVILAVTTVGQA-APSISRVVNGTDSSVLKYPFVVSLR--SYDGS---HSCGGSIISKHFVM 67
            |:.|:|.|:..:|.: .|.|   :.||::::.::|:.|||:  ..:||   |.|.||||::.:::
Mosquito     4 LAFIIIPALIALGHSIRPPI---IEGTEANLHEFPYQVSLQWNFNNGSRARHFCSGSIINQRWIL 65

  Fly    68 TAAHCTNGRPAD-TLSIQFGVTNIS--AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFE 129
            |||||......| ...:..||.||:  ..|.....:.:..|||.:|.:... .||.:|.:..|.:
Mosquito    66 TAAHCLEEYTKDGWFEVVAGVNNIAHEEAGAQRRNVTRYEQHESYDLSAIR-YDIGVLQLSHPLD 129

  Fly   130 FDGVSVAPVELPALAFAVPQSDAGVEGVLIGWG-LNDTYGSV-QDTLQEVSLKIYSDEECTSRHN 192
            ... ::..:.|......:.|..|    ...||| ::.|:..: .|.|.:|:|.:.::|:|.:  .
Mosquito   130 LTR-NIKTMRLATKDTLIHQKIA----KFAGWGSISKTWEDIYPDKLMKVNLILRTEEDCQT--I 187

  Fly   193 GQTDPKYHICGGVDEGGKGQCSGDSGGPL--IYNGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQY 253
            |:.| :..||.|..:...| |:.||||||  ..:|:  |:|::|:..|||. |..|.||..|..:
Mosquito   188 GKID-ETQICAGGYKNVSG-CTADSGGPLTVTIDGEQMQIGVLSYGEKPCQ-ARLPIVYSSVMYF 249

  Fly   254 VDWIK 258
            .|||:
Mosquito   250 HDWIQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 72/241 (30%)
Tryp_SPc 30..260 CDD:238113 74/243 (30%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 75/246 (30%)
Tryp_SPc 23..253 CDD:214473 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.